SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|432330476|ref|YP_007248619.1| from Methanoregula formicica Methanoregula formicicum SMSP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|432330476|ref|YP_007248619.1|
Domain Number 1 Region: 206-364
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 4.6e-22
Family MJ1460-like 0.0081
Further Details:      
 
Domain Number 2 Region: 50-182
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 1.1e-16
Family MJ1460-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|432330476|ref|YP_007248619.1|
Sequence length 368
Comment putative hydrocarbon binding protein (contains V4R domain) [Methanoregula formicica SMSP]
Sequence
MKIGREDFEALMKGEKTIAPYVELDPAAGIYSVFGVRTAGNPNYLVRAIYEMYEASLNRK
LAVKAVRKLFRSVGQGSVGLASLLKKQGMELTTAQFVMLVFTLQHQQGWGAPLELVEAGE
KRIVLRTKQTFESEVLKDWNMPVCGIHQGWIEGVLKAVTGKTWFCLEKSCHAQGNPYCEF
VCDQVEPSWKFKAEAVVKGESAITEFIDHKPLQGTIQLIDEPVVMMPRFIFTSMTQSLKK
TMGEAPANGVNYRAYMDMGKENVEHYKKMGITNPKTLSDMAFAFYAQMGWFRLVSEEWDE
ASKTKTITLSHTVESESFGATGKNVCFCTAGLLAGIIEGAFGIKVQAKEIRCKSKGDDHC
VFSITNRS
Download sequence
Identical sequences L0HBI8
gi|432330476|ref|YP_007248619.1| WP_015285076.1.81074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]