SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|432330636|ref|YP_007248779.1| from Methanoregula formicica Methanoregula formicicum SMSP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|432330636|ref|YP_007248779.1|
Domain Number 1 Region: 5-113
Classification Level Classification E-value
Superfamily GlnB-like 0.00000000000635
Family Prokaryotic signal transducing protein 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|432330636|ref|YP_007248779.1|
Sequence length 123
Comment nitrogen regulatory protein PII [Methanoregula formicica SMSP]
Sequence
MKTLKLVRALFPPDKITIITAALEENGFFRMLFTPVEGTAKRHSSSFFACRSFRDSNLLP
WIQLEMVVDYSRTDELISTLMDTCQARGIDIHIHILPVEKAIFPGNGEIPDDSLAGGSSG
ITV
Download sequence
Identical sequences L0HC18
gi|432330636|ref|YP_007248779.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]