SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|432331096|ref|YP_007249239.1| from Methanoregula formicica Methanoregula formicicum SMSP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|432331096|ref|YP_007249239.1|
Domain Number 1 Region: 123-208
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000981
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|432331096|ref|YP_007249239.1|
Sequence length 219
Comment Stigma-specific protein, Stig1 [Methanoregula formicica SMSP]
Sequence
MRSCPSCGAPAKPVDKFCGQCGAQLGTVTEIDGNEQTPRAPAFSKKVLIVILATGIIIAI
AVGAIFLKSEGNATGNPVAANRTPSSYVIIETEAPLPAISTTPLITATPSPTAIPTTVTT
PKHSTCPTDRRLCGTNCTDTLTDSSNCGYCGNACPRGQACVNGHCMLDCPAGKTACVEGC
FNLETDPDHCGICSNNCPAGLVCSKGQCAPPPTTINRAL
Download sequence
Identical sequences L0HDE7
gi|432331096|ref|YP_007249239.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]