SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|432332171|ref|YP_007250314.1| from Methanoregula formicica Methanoregula formicicum SMSP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|432332171|ref|YP_007250314.1|
Domain Number 1 Region: 2-79
Classification Level Classification E-value
Superfamily Homeodomain-like 3.89e-17
Family Tetracyclin repressor-like, N-terminal domain 0.0022
Further Details:      
 
Domain Number 2 Region: 80-190
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00000000381
Family Tetracyclin repressor-like, C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|432332171|ref|YP_007250314.1|
Sequence length 191
Comment transcriptional regulator [Methanoregula formicica SMSP]
Sequence
MREPSPDKQEAILETALRLFTERGFAGTPTSLISKEAGVATGTLFFYFKTKEELIDTLYR
RVKSEAAQAMGRGLDAEKTAKDKFCRLGKNAAGWGIRNPAKLKFMEQFAHSPFVSTSAHE
EGMSHFLFLEELVRQGIRDGEIRNVEPSGLFCLMASALSGMIAHALSTDDRKERERIIED
GLDFIWFGMKA
Download sequence
Identical sequences L0HGE6
gi|432332171|ref|YP_007250314.1| WP_015286769.1.81074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]