SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001754 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001754
Domain Number 1 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-23
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 3 Region: 273-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.95e-23
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 399-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 217-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 162-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000123
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 321-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000155
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001754   Gene: ENSMMUG00000001316   Transcript: ENSMMUT00000001859
Sequence length 462
Comment pep:known chromosome:MMUL_1:19:58325295:58333776:1 gene:ENSMMUG00000001316 transcript:ENSMMUT00000001859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHLTFRDVAIEFSQEEWKCLDPVQKALYRDVMLENYRNLVSLGICLPDLSIISMMKQRTE
PWTVENEMKVAKNPVRWEGIKDINTGRCCAMRSKAGNKPITNQLGLTFQLPLPELEIFQG
EGKIYECNQVEKFISHSSSVSPLQIFYSGVKTHIFYKHRSDFVDFPLLSQEQKAHIRRKP
YECNEQGKVFRVSSSLPNHQVIHTADKPNRCHQCGKAFRYKSGLAEHWKIRPGEKPYKCK
ECGKLFNRIAYLARHEKLHTGESPYKCNECGKVFSRITYLVRHQKIHTGEKPHKCNECGK
VYSSSSYLAQHWRIHTGEKLYKCNKCGKEFSGHSSLTTHLLIHTGEKPYKCKECDKAFRH
KFSLTVHQRNHNGEKPYKCHECGKVFTQVSHLARHQKIHTGEKPYKCNECGKVFTQNSHL
ANHQRIHTGEKPYKCRVCGKVFRHSSWLVQHQRSIHERVLTN
Download sequence
Identical sequences G7NMG8 G7PYP3
9544.ENSMMUP00000001754 ENSMMUP00000001754 ENSMMUP00000001754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]