SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002922 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002922
Domain Number 1 Region: 109-246
Classification Level Classification E-value
Superfamily C-type lectin-like 1.08e-33
Family C-type lectin domain 0.0000757
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002922   Gene: ENSMMUG00000002192   Transcript: ENSMMUT00000003096
Sequence length 248
Comment pep:known chromosome:MMUL_1:11:10310899:10322619:-1 gene:ENSMMUG00000002192 transcript:ENSMMUT00000003096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYHPDLENLDEDGYTQLHFDSRSNTRIAVVSEKGSCVASPPWRLIAVILGILCLVILVI
AVVLGTMAIWRPNSGRNSLENGYFPSRNKENHSQPTQSPLEESVTPTKAVKTTGKGISIP
CPPNWIIYEKSCYLFSPSLNSWDQSKRQCSQLGSNLIKIDSSKELGFIVKQVSSQPDNSF
WIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYS
ICEKKFSM
Download sequence
Identical sequences ENSMMUP00000002922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]