SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003116 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003116
Domain Number 1 Region: 393-500
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 5.63e-17
Family Mannose 6-phosphate receptor domain 0.0072
Further Details:      
 
Domain Number 2 Region: 68-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000406
Family LDL receptor-like module 0.0048
Further Details:      
 
Domain Number 3 Region: 194-258
Classification Level Classification E-value
Superfamily EF-hand 0.000058
Family Calmodulin-like 0.062
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003116
Domain Number - Region: 31-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000196
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number - Region: 127-221
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0023
Family FCH domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003116   Gene: ENSMMUG00000002328   Transcript: ENSMMUT00000003300
Sequence length 516
Comment pep:known_by_projection chromosome:MMUL_1:19:11259052:11272134:1 gene:ENSMMUG00000002328 transcript:ENSMMUT00000003300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPLLLLLPMCWAVEVKRPRGVSLTNHHFYDESKPFTCLDGSATIPFDQVNDDYCDCKD
GSDEPGTAACPNGSFHCTNTGYKPLYIPSNRVNDGVCDCCDGTDEYNSGIVCENTCKEKG
RKERESLQQMAEVTREGFRLKKILIEDWKKAREEKQKKLTELQAGKKSLEDQVEMLRTVK
EEAEKPEKEAKEQHQKLWEEQLAAAKVQREQELAADAFQELDDDMDGTVSVTELQTHPEL
DTDGDGALSEAEAQALLSGDTQTDATSFFDRVWAAIRDKYRSEALPTDLPAPSAPDLTEP
KEEQPPVPSPPTEEEEEEEEEEEAEEEEEEEEDSEEALLPLAPPQPASPAEEDKMPPYDE
QTQAFIDGEGGPGPGSAGEPSVSCRGGVDQGRSELSPCSDSASTPQYLGEYVYRLCPFKL
VSQKPKLGGSPTSLGTWGSWAGPEHDRFSAMKYEQGTGCWQGPNRSTTVRLLCGKETMVT
STTEPSRCEYLMELMTPAACLEPPPEAPTEDDHDEL
Download sequence
Identical sequences ENSMMUP00000003116 9544.ENSMMUP00000003116 ENSMMUP00000003116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]