SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003150 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003150
Domain Number 1 Region: 364-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.54e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 420-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 308-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 466-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.68e-21
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 254-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 41-92
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-18
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 7 Region: 217-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000016
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003150
Domain Number - Region: 176-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.023
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003150   Gene: ENSMMUG00000002354   Transcript: ENSMMUT00000003337
Sequence length 523
Comment pep:known chromosome:MMUL_1:16:15413302:15429816:1 gene:ENSMMUG00000002354 transcript:ENSMMUT00000003337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMETDLTEMPEKRALSSQDSPHFQEKSTEEGEVAALRLTARSQETVTFKDVAMDFTPEE
WGKLDPAQRDVMLENYRNLVSLWLPVSKPENYNLENGKEPLKLERKTPKSSYSDVETRPQ
SKDSTSVQDFSKAESCKVALIDRLTRNSVYDSNLEAALECENWLENQPGNQERHLREMFT
HMNSLSEETDHEHDVCWKSFNQKSVLITEDRVPKGSYAFHTLEKRLKQKSNLMKKQKTYK
EKKPHKCNDCGELFTYHSVLIRHQRVHTGEKPYTCNECGKSFSHRANLTKHQRTHTRILF
ECSECKKTFTESSSLATHQRIHVGERPYECNECGKGFNRSTHLVQHQLIHTGVKPYECNE
CDKAFIHSSALIKHQRTHTGEKPYKCQECGKAFSHCSSLTKHQRVHTGEKPYECSECGKT
FSQSTHLVQHQRIHTGEKPYECNECGKTFSRSSNFAKHQRIHIGKKPYKCSECGKAFIHS
SALIQHQRTHTGEKPFRCNECGKSFKCSSSLIRHQRVHTEEQP
Download sequence
Identical sequences F7C0L6 G7PTR0
ENSMMUP00000003150 XP_001086248.2.72884 XP_005583019.1.63531 XP_005583020.1.63531 XP_014974140.1.72884 ENSMMUP00000003150 9544.ENSMMUP00000003150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]