SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003357 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003357
Domain Number 1 Region: 23-84
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-21
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 2 Region: 287-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-16
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 3 Region: 374-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000217
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003357   Gene: ENSMMUG00000002497   Transcript: ENSMMUT00000003552
Sequence length 524
Comment pep:known chromosome:MMUL_1:3:186747996:186772072:-1 gene:ENSMMUG00000002497 transcript:ENSMMUT00000003552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENLLKNRNFWILRLPPGSNGEVPKVPVTFDDVAVHFSEQEWGNLSEWQKELYKNVMRGN
YESLVSMDYAISKPDLMSQMERGERPTMQEQEDSEEGETPTDPSAAHDGIVIKIEVQTND
EGSESLETPEPLMGQVEEHGFQDSELGDPCGEQPDLDMQEPENTLEESTEGSSEFSELKQ
MLVQQRNCTEGIVIKTEEQDEEEEEEEEDELPQHLQSLGQLSGRYEASMYQTPLPGEMSP
EGEESPPPLQLGNPAVKRLAPSMHGERHLSENRGASSQQQRNRRGERPFTCMECGKSFRL
KINLIIHQRNHIKEGPYECAECEISFRHKQQLTLHQRIHRVRGGCVSPERGPTFNPKHAL
KPRPKSPSSGSGGSGPKPYKCPECDSSFSHKSSLTKHQITHTGERPYTCPDARPATAARR
GARAEPPGHRQARAQRGRGAPQPLCREPLSFRPSSQGHGGSETRSLAAAFPGPQGGGRGP
GEPFRDVNFLDNKMDETNQHGGRDLAAGHSEGRCRAHLVGDRTL
Download sequence
Identical sequences ENSMMUP00000003357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]