SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003822 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003822
Domain Number 1 Region: 2-112
Classification Level Classification E-value
Superfamily C-type lectin-like 1.49e-27
Family C-type lectin domain 0.00000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003822   Gene: ENSMMUG00000002857   Transcript: ENSMMUT00000004048
Sequence length 114
Comment pep:known_by_projection chromosome:MMUL_1:13:79431292:79433474:1 gene:ENSMMUG00000002857 transcript:ENSMMUT00000004048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDADLTCQKRPSGNLVSVLSGAEGSFVSSLVRSISNSYSYVWIGLHDPTQSSEPDGDGWE
WSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDNNCDAKLPYVCKFKD
Download sequence
Identical sequences ENSMMUP00000003822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]