SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003961 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003961
Domain Number 1 Region: 20-81
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.15e-21
Family KRAB domain (Kruppel-associated box) 0.00089
Further Details:      
 
Domain Number 2 Region: 184-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000109
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 153-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000175
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003961   Gene: ENSMMUG00000002966   Transcript: ENSMMUT00000004199
Sequence length 269
Comment pep:known_by_projection chromosome:MMUL_1:4:29409813:29413524:-1 gene:ENSMMUG00000002966 transcript:ENSMMUT00000004199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEQLKPIEPRDCWREAWVKKKPVTFEDVAVNFTQEEWDCLDASQRVLYQDVMSEIFKNL
ASVARIFLHKPELITKLEQEEEQWREFVHLPNTEGLSEGKKKELREQHPSLRDEGTSDDK
VFLACRGAGQCPLSAPAGSMDRTQVLQASQAGPPFFCRICGKCFSRRSYLYSHQFVHNPK
LTNSCSQCGKLYCDASGLSRHRRVHLGYRPHSCSVCGKSFRDQSELKRHQKIHQNQEPVD
GNQECTLRIPGTPAELQTPIPRSQRSIQG
Download sequence
Identical sequences ENSMMUP00000003961 ENSMMUP00000003961 9544.ENSMMUP00000003961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]