SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004213 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004213
Domain Number 1 Region: 1-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-25
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 2 Region: 365-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.27e-24
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 197-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.53e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 253-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 5 Region: 309-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-20
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 6 Region: 159-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-19
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 407-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000181
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004213   Gene: ENSMMUG00000003150   Transcript: ENSMMUT00000004464
Sequence length 457
Comment pep:known_by_projection chromosome:MMUL_1:11:134352239:134377090:1 gene:ENSMMUG00000003150 transcript:ENSMMUT00000004464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQGSVTFRDVAIDFSQEEWKWLQPAQRDLYRCVMLENYGHLVSLGLSISKPDVVSLLEQ
GKEPWLGKRNVNRDLFSVSESSGDIKDFSPKNVIYDDSSQYLIMERILSQGPVYSNFKGG
WKCKDHTEMLQENKGCIRKVTVSHQEALAQHMNISTVERPYGCHECGKTFGRRFSLVLHQ
RTHTGEKPYACKECGKTFSQISNLVKHQMIHTGKKPHECKDCNKTFSYLSFLIEHQRTHT
GEKPYECTECGKAFSRASNLTRHQRIHIGKKQYICRKCGKAFSSGSELIRHQITHTGEKP
YECIECGKAFRRFSHLTRHQSIHTTKTPYECNECRKAFRCHSFLTKHQRIHAGEKLYECD
ECGKVFTWHASLIQHTKIHTGEKPYACAECDKAFSRSFSLILHQRTHTGEKPYVCKVCNK
SFSWSSNLAKHQRTHTLDNPYEYENSFNYHSFLTEHQ
Download sequence
Identical sequences A0A1D5R5L2 A0A2K5X893
ENSMMUP00000004213 ENSMMUP00000004213 9544.ENSMMUP00000004213 XP_005572761.1.63531 XP_014965251.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]