SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005319 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005319
Domain Number 1 Region: 320-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.1e-25
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.11e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 208-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.26e-22
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 5 Region: 376-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 156-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.97e-18
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 7 Region: 422-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.76e-17
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005319   Gene: ENSMMUG00000003989   Transcript: ENSMMUT00000005651
Sequence length 475
Comment pep:known_by_projection chromosome:MMUL_1:1:3626147:3644456:-1 gene:ENSMMUG00000003989 transcript:ENSMMUT00000005651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELLTFRDVAIEFSPEEWKCLDPAQQNLYRDVMLENYRNLVSLGVAISNPDLVTCLEQRKE
PYNVKIRKIVARPPAVRSHFTQDRWPVQGIEDSFHNLILRRYEKCRHENLQLRKGCKSLN
DCKLQKGGYNEFNECLSTTQSKIFQCKANIKVVSKFSKLNKRKTRHTGEKQFKCKECGKS
FPKFSHLTQHKVIHAGEKPYTCEECGKAFKWSLIFNEHKRIHTGEKPFTCEECGSIFTTS
SHFAKHKIIHTGEKPYKCEECGKAFNRFTTLTKHKRVHAGEKPITCEECRKIFTSSSNFA
KHKRIHTGEKPYKCEECGKAFNRSTTLTKHKRIHTGEKPYTCEECGKSFRQSSKLNEHKK
VHTGEKPYKCDECGKAFGRSRVLNEHKKIHTGEKPYKCEECGKAFRRSTDRSQHKKIHST
AKPYKCKECDKAFKQFSLLSQHKKIHTVDKPYKCKDCDKAFKRFSHLNKHKKIHT
Download sequence
Identical sequences ENSMMUP00000005319 9544.ENSMMUP00000005319 ENSMMUP00000005319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]