SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005833 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005833
Domain Number 1 Region: 359-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 303-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-22
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 405-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.51e-21
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 2-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.75e-21
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 5 Region: 247-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.81e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 150-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000363
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 179-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000184
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005833   Gene: ENSMMUG00000031191   Transcript: ENSMMUT00000006201
Sequence length 460
Comment pep:known_by_projection chromosome:MMUL_1:1:209982792:209994287:1 gene:ENSMMUG00000031191 transcript:ENSMMUT00000006201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLLAFRDVALEFSPEEWECLDPAQRNLYRDVMLENYRNLFSLGEDHFNMQFLFHRLAMSK
PELIIYLEARKEPWNVNTEKTAKHSALSSYLTEDILPEQGLQISFQKVMLRRYERCCLEK
LHLRNDWEIVGEWKGQKASYNGLDLCSATTHNKNFQCKKCVKGFSKFASLNKHKISHTGE
KPFKCKECGNVSCMSLITTQQQRIHIGENPYQRKKGSKAFNERSYFTDYKRIHVGEQHCR
CEECNNVFKSCSSLAIIEKIHTEKKTYKCEECGKAFNLCSILTKHKKIHTGEKPYKCEEC
GKSFKLFPYLTQHKRIHSGEKPYKCEECGKVFKLLSYLTQHKRIHTGEKTFQCEECGKAF
NQSSHLTEHRRIHTGEKPYKCQECGKAFTWFSYLIQHKRIHTGQKPYICEECGKAFTWFS
YLNQHKRIHTGEKPYKCDECGKAFNWFSYLTNHKRIHTGE
Download sequence
Identical sequences 9544.ENSMMUP00000005833 ENSMMUP00000005833 ENSMMUP00000005833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]