SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006666 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000006666
Domain Number - Region: 46-78
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0225
Family EGF-type module 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006666   Gene: ENSMMUG00000005035   Transcript: ENSMMUT00000007095
Sequence length 158
Comment pep:known chromosome:MMUL_1:4:72055418:72069586:-1 gene:ENSMMUG00000005035 transcript:ENSMMUT00000007095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRLSGTSALPVKVKPEFYRQAELKPCPWTGSNQRRCIAFCPTPDQADPCKFLACGEFAQC
VKNEWTEEVECRCKPGYESQAGLDGLEPGLCGPGTKECEVLQGKGAPCRLPDHSENQAYK
TSVKKFQNQQNNKVISKRNSELLTVEYEEFNHQDWEGN
Download sequence
Identical sequences ENSMMUP00000006666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]