SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006690 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006690
Domain Number 1 Region: 573-728
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-37
Family MAM domain 0.00081
Further Details:      
 
Domain Number 2 Region: 891-1054
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.23e-33
Family MAM domain 0.0026
Further Details:      
 
Domain Number 3 Region: 63-220
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-32
Family MAM domain 0.0049
Further Details:      
 
Domain Number 4 Region: 730-888
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.28e-28
Family MAM domain 0.0018
Further Details:      
 
Domain Number 5 Region: 270-423
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-18
Family MAM domain 0.013
Further Details:      
 
Domain Number 6 Region: 225-264
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000353
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 7 Region: 489-571
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000222
Family MAM domain 0.026
Further Details:      
 
Domain Number 8 Region: 456-494
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000746
Family LDL receptor-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000006690
Domain Number - Region: 31-51
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.089
Family LDL receptor-like module 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006690   Gene: ENSMMUG00000005048   Transcript: ENSMMUT00000007119
Sequence length 1137
Comment pep:known_by_projection chromosome:MMUL_1:15:1397269:1405429:-1 gene:ENSMMUG00000005048 transcript:ENSMMUT00000007119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPSHLLPALVLLLGKSPGWAWVPSHCRSPGQAACNFVCDCRDCSDEAQCGYRGASPAL
GTPFACDFEQDSCGWRDISTSGYSWLRDRAGAALEGPGPHSDHTLGTDLGWYMAVGTHRG
KEASTAALRSPTLREAAPSCKLRLWYHAASGDVAELRLEVTHGSETLTLWQSTGPWDPGW
QELAVTTGRIRGDFRVTFSATRNATHRGAVALDDLAFWDCGLPTPQASCPLGHHHCQNKV
CVEPQQLCDGEDNCGDLSDEDPLTCGRHTATDFETGLGPWNRSEGWSRNHSAGGPERPSW
PRRDHSRNSAQGSFLVSVAEPGTPAILSSPAFQASGASNCSLIFYHYLHGSEAGCLQLFL
QTLGSSAPQAPVLLRRRRGELGTAWVRDRVDIQSAHPFQILLAGQTGPGGVVGLDDLILS
DHCRPVPEVSTLQPLPPGPWAPVPQPLPPSSRLQDSCKQGHFACGDLCVPPEQLCDFEEQ
CAGGEDEQACGTTDFESLEAGGWEDASVGRLQWRRLSAQESQGSSAAAAGHFLSLQRAWG
QLSTEARVLTPLLGPSGPSCELHLAYYLQSQPREVSCNFERDTCSWYPGHLSDTHWRWVE
SRGPDHDHTTGQGHFVLLDPTDPLAWGHSAHLLSRPQVPAAPTECLSFWYYLHGPQIGTL
RLAMRREGEETHLWSRSGTQGNRWHEAWATLSHQPGSRAQYQLLFEGLRDGYHGTMALDD
VAVRPGPCWAPHHCSFEDSDCGFSSGGRGLWRRQANASGHTAWGPPTDHTTETAQGHYMV
VDTSPDALPRGQTASLTSKEYSPPAQPACLTFWYHGSLHNPGTLRVHLEKGRKHQVLSLS
AHGGLAWRLGSVDVQAEQAWRVVFEAVAAGVAHSYVALDDLLLQDGPCPRPGSCDFESGL
CGWSHLAWPSLGGYSWDWGGGATPSRYPQPPVDHTLGTKAGHFAFFETGVLGPGGRAAWL
RSEPLPATPASCLRFWYHMGFPEHFYKGELRVLLRSTQGQLAVWGTGGHRRHQWLEAQVE
VASTKEFQVVFEATLGGQPALGPIALDDVEYLAGQRCQQPAPSPGDTAAPVSVPTAVGSA
LLLLMLLVLLGLGGRRWLQKRGSCPFQSNTEATAPGFDNILFNADGVTLPASVTSDP
Download sequence
Identical sequences 9544.ENSMMUP00000006690 ENSMMUP00000006690 ENSMMUP00000006690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]