SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011070 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011070
Domain Number 1 Region: 601-673
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000133
Family Anti-sigma factor antagonist SpoIIaa 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011070   Gene: ENSMMUG00000008442   Transcript: ENSMMUT00000011804
Sequence length 800
Comment pep:known_by_projection chromosome:MMUL_1:4:35698389:35773749:-1 gene:ENSMMUG00000008442 transcript:ENSMMUT00000011804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQLERSAISGFSSKSRQSSFPYDVKREVYNEETFQQEHKRKASSSGNMNINITTFTHHV
QCRCSWHRFLRCMLTIFPFLEWMCMYRLKDWLLGDLLAGISVGLVQVPQGLTLSLLARQL
IPPLNIAYAAFCSSVIYVIFGSCHQMSIGSFFLVSALLINVLKISPFNNGHLVMGSFLKD
EFSAPSYLMGYNKSLSVVATTTFLTGIIQIIGFTVIANKITMATETSQTLIDMIPYSFLF
PVTPDFSVLPKIILQAISLSLVSSFLLIFLGKKIASLHNYSVNSNQDLIAIGLCNVVSSF
FRSCVFTGAVARTIIQDKSGGRQQFASLVGAGVMLLLMVKMGHFFYALPNAVLAGIILSN
VVPYLETISNLPSLWRQDQYDCAMDLKNTNSSLMPSAPVLLYKGESRLLVQENTKTSFQL
RQIKYLNGYESPIPIREGGVLSGRIPAGAHCVSLEHKTRGNFSLFFFCVDEKDVLSLTHW
DSDEHQKLGGGCRGCPPLTLSSQILYTERFENKLDPDASSVNLIHCSHFESVNTSQTASE
DQVPYTVSSMSQKNQGQQYEEVEKVWLPNNSSRNSSPGLPDVAESQGRRSLIPYSDASLL
PSVHTIILDFSMVHYVDSQGLVVLRQICNAFRNANILILIAGCHSSIVRAFERNDFFDAG
ITKTQLFLSVHDAVLFALSRKVIDSSELSIDESETVIRETYSETEKNDNSIYKMSSSFLG
SQKNVSPGFTKIQQPVEPEMEPDPKFRSRAHTFPQQHYWPTYHPRTASTQSQTQPRTWSV
ERRRHPMDSYSPEGNSNEDV
Download sequence
Identical sequences ENSMMUP00000011070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]