SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012986 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012986
Domain Number 1 Region: 730-975
Classification Level Classification E-value
Superfamily Tropomyosin 0.000024
Family Tropomyosin 0.0017
Further Details:      
 
Domain Number 2 Region: 627-723
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000392
Family Tropomyosin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012986   Gene: ENSMMUG00000009925   Transcript: ENSMMUT00000013859
Sequence length 1141
Comment pep:known chromosome:MMUL_1:5:73349641:73421904:-1 gene:ENSMMUG00000009925 transcript:ENSMMUT00000013859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTAVERKYINIRKRLDQLGYRQTLTVECLPLVEKLFSDLVHTTESLRQSKLSTVKAEKE
SANFDFVLEPYKLENARLSRENNELYLELMKLREHSDQHVKELKTSLKKCARETDDLKFL
NNQYVHKLKLLEKESKAKNERIQQLQEKNLHAVVQTPGGKKRSIAFRRQRMQIDEPVPPS
EVSSYPVPQPDDPYIADLLQVADNRIQELQQEVHQLQEKLAVMESGVSDYSKQIELRERE
IERLSVALDGGRSPDVLSLESRNKTNEKLIAHLNIQVDFLQQANKDLEKRIRELMETKET
VTSEVVNLSNKNEKLCQELTEIDQLAQQLERHKEEVLETADKELGEAKKEIKRKLSEMQD
LEETMAKLQLELNLCHKEKERLSDELLVKSDLETVVHQLEQEKQRLSKKVESFVVTEREL
TLEVERMRLEHGIKRRDRSPSRLDTFLKGIEEERDYYKKELERLQHIIQRRSCSTNYGAR
EKNSIFRTPEKGDYNSEIHQITRERDELQRMLERFEKYMEDIQSNVKLLTAERDKLSVLY
NEAQEELSALRKESTQTTAPHNIVSLMEKEKELALSDLRRIMAEKEALREKLEHIEEMSL
FGKSELEKTIEHLTCVNHQLESEKYELKSKVLIMKETIESLENKLKVQAQKFSHVAGDSS
HQKTEVNSLRIVIEQLQRSVDDYQHRLSIKRGELESAQAQIKILEEKIDELNLKMTSQDE
EAHVMKKTIGVIDKEKDFLQETVDEKTEKIADLQENLANKEKTVAQMKLMISECESAVNQ
LKETLVNRDREINSLRRQLDAAHKELDEVGRSREIAFKENRRLQDDLATIARENQEISLE
LEAAVQEKEEMKSRVHKYITEVSRWESLMAAKEKENQDLLDRFQMLHNRAEDWEVKAHQA
EGESSSVRLELLSIDTERRHLRERVELLEKEIQEHINAHHAYESQISSMAKAMSRLEEEL
RHQEDEKATVLNDLSSLRELCIKLDSGKDIMTQQLNSKNLEFERVRKRNCLGKFFALSFR
VECSGAISTHHNLRLLGSTSKPPEFETSLVSRDCATALQLGQQSETLSQKKKKKKKNREN
TMLRAKVAQLQTDYDALKRQISTERYERERAIQEMRRHGLPTPPLSSTLRSPSHSPEHIN
A
Download sequence
Identical sequences ENSMMUP00000012986 9544.ENSMMUP00000012986 ENSMMUP00000012986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]