SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014126 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014126
Domain Number 1 Region: 431-604,632-700
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000011
Family Voltage-gated potassium channels 0.023
Further Details:      
 
Domain Number 2 Region: 78-316
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000149
Family Voltage-gated potassium channels 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014126   Gene: ENSMMUG00000010784   Transcript: ENSMMUT00000015074
Sequence length 752
Comment pep:known_by_projection chromosome:MMUL_1:14:5672294:5709455:-1 gene:ENSMMUG00000010784 transcript:ENSMMUT00000015074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESRAESEPLLGRARGGGSDCPAGLTTCRSIQVGPGAAARWDLCIDQAVVFIEDAIQYR
SINHRVDASSMWLYRRYYSNVCQRTLSFTIFLILFLAFIETPSSLTSTADVRYRAAPWEP
PCGLTESVEVLCLLVFAADLSVKGYLFGWAHFQKNLWLLGYLVVLVVSLVDWTVSLSLVC
HEPLRVRRLLRPFFLLQNSSMMKKTLKCIHWSLPEMASVGLLLAIHLCLFTMFGMLLFAG
GKQDDGQDRERRTYFQNLPESLTSLLVLLTTANNPDVMIPAYSKNRAYAIFFIVFTVIGD
LFLMNLLTAIIYSQFRGYLMKSLQTSLFRRRLGTRAAFEVLSSTAGEGGAFPQTVGVKPQ
NLLQVLQKVQLDSSHKQAMMEKVRSYGSVPLSADEFQKLFNELDRSVVKEHPPRPEYQSP
FLQSAQFVFGHYYFDYLGNLIALANLVSICVFLVLDADVLPVERDDFVLGILNCVFIVYY
LLEMLLKVFALGLRGYLSYPSNVFDGLLTIVLLVLEISTLAVYRLPRPGWRPEMLGLLSL
WDMTRMLNMLIVFRFLRIIPSMKPMAVVASTVVGLVQNMRAFGGILVVVYYEFAVIGISL
FRGVIVAPPGNSSLASANGSAPCGSFEQLEYWANNFDDFAAALVTLWNLMVVNNWQVLLD
AYRRYSGPWSKIYFVLWWLVSSVIWVNLFLALILENFLHKWDPQSHLQPLAGTAEATYQM
TVELPFRDILEEPREDELMERLNQHPHLQLCR
Download sequence
Identical sequences ENSMMUP00000014126 9544.ENSMMUP00000014126 ENSMMUP00000014126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]