SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014189 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014189
Domain Number 1 Region: 231-288,326-450
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000369
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 493-549
Classification Level Classification E-value
Superfamily EF-hand 0.0000608
Family Calmodulin-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014189   Gene: ENSMMUG00000010818   Transcript: ENSMMUT00000015140
Sequence length 661
Comment pep:known_by_projection chromosome:MMUL_1:9:99890339:99901760:-1 gene:ENSMMUG00000010818 transcript:ENSMMUT00000015140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPVTYGMTSSSAYYYTKVMSELFLHTASDTGVSFQAISSMADFWDFAQGPLLDSLYWTKW
YNNQSLGHGSHSFIYYENLLLGVPRLRQLKVRNDSCVVHEDFREDILSCYDVYSPDKEEQ
LPFGPLNGTAWTYHSQDELGGSSHWGRLTSYSGGGYYLDLPGSRQGSAEALRDLQEGLWL
DRGTRVVFIDFSVYNANINLFCVLRLVVEFPARRCHPILANPHGQADPLCQQLFFIVGCE
VVFCVFIFYYVVEEILELHIHRLRYLSSIWNILDLVVILLSIVAVGFHIFRTLEVNRLMG
KLLQQPNTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKD
ILGFAVMFFIVFFAYAQLGYLLFGTQVENFSTFIKCIFTQFRIILGDFDYNAIDNANRIL
GPAYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDELQLSDLLKQGYNKTLLRLR
LRKERVSDVQKVLQGGEQEIQFEDFTNTLREMGHAEHEITELTATFTKFDRDGNRILDEK
EQEQMRQDLEGERVALDTEIEKLGRSVVSTPQGESGPEAAKAGGWVSGEEFYMLTRRVLQ
LETVLEGVVSQVDAVGSKLKMLETKGWLVPSPGVEEQAIWKHLQPAPAVTPDPWGPGWAG
E
Download sequence
Identical sequences ENSMMUP00000014189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]