SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016607 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016607
Domain Number 1 Region: 57-153,300-425
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 3.66e-27
Family Calcium ATPase, transmembrane domain M 0.031
Further Details:      
 
Domain Number 2 Region: 157-222,258-295
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.000000000000017
Family Calcium ATPase, transduction domain A 0.0078
Further Details:      
 
Domain Number 3 Region: 418-486
Classification Level Classification E-value
Superfamily HAD-like 0.000000445
Family Meta-cation ATPase, catalytic domain P 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016607   Gene: ENSMMUG00000012643   Transcript: ENSMMUT00000017733
Sequence length 528
Comment pep:known_by_projection chromosome:MMUL_1:6:157022140:157078057:-1 gene:ENSMMUG00000012643 transcript:ENSMMUT00000017733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSVDSSWHRWQWRVRDGFPDCPSETTPLLSPEKGRQSYNLTQQRIVFPNNSIFHQDWE
EVSRRYPGNRTCTTKYTLFTFLPRNLFEQFHRWANLYFLFLVILNWMPSMEVFHREITML
PLAIVLFVIMIKDGMEDFKRHRFDKAINCSNIRIYERKEQTYVQKCWKDVRVGDFIQMKC
NEIVPADILLLFSSDPSGICHLETASLDGETNLKQRRVVKGFSQQEVQFEPELFHNTIVC
EKPNNHLNKFKGYMEHPDQTRTGVGCESLLLRGCTIRNTEMAVGIVIYAGHETKAMLNNS
GPRYKRSKIERRMNIDIFFCIGILILMCLIGAVGHSIWNGTLEEHPPFDVPDANGSFLPR
ALGGFYMFLTMIILLQVLIPISLYVSIELVKLGQVFFLNNDLDLYDEETDLSIQCRALNI
TEDLGQIQYIFSDKTGTLTENKMVFRRCTIMGSEYSHQENGTRAPKGSIPLSKRKCPALL
RKEIKDILLTLLEAVWHFHKLLPVSLWSSLSQIRAVPITCKFSFVYKS
Download sequence
Identical sequences ENSMMUP00000016607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]