SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016819 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016819
Domain Number 1 Region: 556-612
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 612-668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 668-724
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 500-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.13e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 821-873
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.14e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 780-836
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-21
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 7 Region: 724-780
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.59e-21
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 8 Region: 1-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.89e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 9 Region: 389-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000012
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 10 Region: 309-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000753
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 11 Region: 434-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000032
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 12 Region: 238-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000693
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016819   Gene: ENSMMUG00000012802   Transcript: ENSMMUT00000017960
Sequence length 907
Comment pep:known chromosome:MMUL_1:19:50744648:50776525:-1 gene:ENSMMUG00000012802 transcript:ENSMMUT00000017960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTFKDVAVVFTEEELGLLDSVQRKLYRDVMLENFRNLLLVAHQPFKPDLISQLEREEKL
LMVETETPKDGCSGRKNQQKMESIQEVTVSYLSPKELSSCQTWQQSAGGLIRCQDFLKVF
QGKNSQLQEQGDSLCQVWAGIPVQISEDENYILTHIGNGSNYIKSQEYPSWRAHHSWRKM
YLKESCNYQCRCQQISMKNNFCKCDSVSWISHHNDKLEVHRKENYSCHDCGEDIVKVSLF
NQDSIQTEEKPYPCTGYRKAFNNDSSSEVHQQFHLKGKPYTYSSHGKGCSYSSLLHHHQN
IQREDDIENSHLKSYQRVHTEEKPCKCSEYGGNFNHYSPLNTYELIHTGEMSYRHNIYEK
AFSHSLDLNSIFRVHTRDEPHEYEENENVFNQSSCLQVHQKIHTEEKLYTDVEYGKSFIC
SSNLDIQHRVHMEENSYNSEECGNDFSLASHFQDLQIVHTKEQPYKRYVCGNSFSHSLYL
QGHPKIHIGEKPHKDCGNGFNWSSKLKDHQRVHTGQKPYKCNICGKGFNHRSVLNVHQRV
HTGEKPYKCEECDKGFSRSSYLQAHQRVHTGEKPYKCEECGKGFSRNSYLQGHQRVHTGE
KPYKCEECGKGFSRSSHLQGHQRVHTGEKPFKCEECGKGFSWSFNLQIHQRVHTGEKPYK
CEECGKGFSKASTLLAHQRVHTGEKPYQCDECGKSFSQRSYLQSHQSVHSGERPYICEVC
GKGFSQRAYLQGHQRVHTRVKPYKCEMCGKGFSQSSRLEAHRRVHTGGKPYKCEVCTKGF
SESSRLQAHQRVHAEGRPYKCEQCGKGFSGYSSLQAHHRVHTGEKPYKCEVCGKGFSQRS
NLQAHQRVHTGEKPYKCDACGKGFRWSSGLLIHQRVHTSDKFYRSEDFGKDYPSSENLHR
NEDSVLF
Download sequence
Identical sequences ENSMMUP00000016819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]