SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017403 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017403
Domain Number 1 Region: 1289-1398
Classification Level Classification E-value
Superfamily C-type lectin-like 1.55e-43
Family Noncollagenous (NC1) domain of collagen IV 0.00000408
Further Details:      
 
Domain Number 2 Region: 1399-1432
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000306
Family Noncollagenous (NC1) domain of collagen IV 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017403   Gene: ENSMMUG00000013235   Transcript: ENSMMUT00000018581
Sequence length 1486
Comment pep:known_by_projection chromosome:MMUL_1:12:91138082:91202740:1 gene:ENSMMUG00000013235 transcript:ENSMMUT00000018581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGAPAEGEDIELDAKGDPGLPGAPGPQGLPGPPGFPGPVGPPGPPGFFGFPGAMGPRGPK
VDYSYQPIPTKGENGVKGLTGPPGPPGTVTVTLTGPDNRTDLKGEKGDKGAIGQPGPPGP
SGLPGESYRSEKGAPGDPGPQGKPGKDGVPGFPGSEGVKGNRGFPGLAGEDGIKGLLYPF
SVFISFSSKTEYYDTYQEKGDEGIPGPPGPKGVRGPQVDMGEEREGRSLRSSRPGLRGAP
GWPGLKGSKGERGRPGKDAMGTPGSPGCPGSPGPPGSPGPPGPPGDIVFRKGPPGDRGLP
GYLGSPGITGVDGPKGEPGLLCTQCPYIPGSPGLPGLPGLHGVKGIPGRPGAAGLKGSPG
SPGNTGLPGIPGFPGAKGDRGLKGEKGETLQPEGQVGAPGDPGLRGQPGRKGLDGIPGTP
GVKGLPGPKGELALSGEKGDQGPPGDPGSPGSPGPAGPAGPPGYGPQGEPGPQGTQGVPG
APGPRGEAGPRGELSVSTPVPGPPGPPGPPGHPGPQGPPGMPGSMGKCGDPGLPGPDGEP
GIPGIGFPGPPGPKGDQGFPGTKGSLGCPGNLGEPGLPGKPGVPGAKGEPAVAMPGGPGT
PGFPGERGNSGEHGEIGLPGLPGLPGTPGNEGLDGPRGDPGQPGPPGEQGPGRCIEGPRG
AQGLPGLNGLKGQQGRRGKMGPKGDPGIPGLDRSGFPGETGSPGMSGHQGETGPPGQKGY
PGNPGILGLPGEDGVVGMMGFPGATGPPGPPGNPGMPGQRGNLGIPGVKGQRGTPGAKGE
QGDKGNPGPSQISHVIGHKGEPGLKGFAGNPGEKGNRGVPGIPGLKGLKGLPGPAGPPGP
RGDLGSTGNAGEPGLRGIPGSMGNMGMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGE
PGYSEGTRPGPPGPTGDPGLPGEMGKKGEMGQPGPPGHSGPAGPEGAPGSPGSPGLPGKP
GPHGDLGFKGIRGFPGPPGIKGPPGLPGFPGSPGPMGVRGDQGRDGIPGPAGEKGEMGLL
RAPPGPRGNPGAQGAKGDRGSPGFPGLPGRKGAMGDAGPRGPTGIEGLPGPPGRPGAIIP
GRKGNHGPPGLRGSPGEPGPPGPPGSHVTGIKGDKGSMGHPGPKGPPGTVGDMGPPGHLG
APGTPGLPGLRGDPGFQGFPGVKGEKGNPGFLGSIGPPGPIGPIGPPGIRGDPGTLKIIS
LPGSPGPPGTPGEPGMQGEPGPPGPPGNLGPCGPRGKPGKDGKPGTPGPAGEKGNKGSKG
EPGPPGSDGLPGLKGKRGDSGSPATWTTRGFVFTRHSQTTAIPSCPEGTAPLYSGFSFLF
VQGNERAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAP
ITGRALEPYISRCTVCEAPAIAIAVHSQTTDIPPCPHGWISLWKGFSFIMKAYSINCESW
RIRKNNKSLSGVHEEKTLKLKKTRTAIFHPKEQSNDRACFYLGIFL
Download sequence
Identical sequences ENSMMUP00000017403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]