SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017493 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017493
Domain Number 1 Region: 16-496
Classification Level Classification E-value
Superfamily ALDH-like 4.32e-184
Family ALDH-like 0.0000000000000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017493   Gene: ENSMMUG00000013303   Transcript: ENSMMUT00000018673
Sequence length 501
Comment pep:known chromosome:MMUL_1:15:81656455:81715152:-1 gene:ENSMMUG00000013303 transcript:ENSMMUT00000018673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSGKPDLPVLPTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKADV
DKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYL
NDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKI
GPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDID
KVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQG
QCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIES
GKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR
ANNTFYGLSAGVFTNDIDKAVTISSALQAGTVWVNCYGVVTAQCPFGGFKMSGNGRELGE
YGFHEYTEVKTVTVKISQKNS
Download sequence
Identical sequences A0A2K6DYN5 F6YY71 Q4R5G3
NP_001270230.1.63531 XP_011769236.1.29376 XP_011769237.1.29376 XP_011769238.1.29376 XP_014973391.1.72884 9544.ENSMMUP00000017493 ENSMMUP00000017493 ENSMMUP00000017493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]