SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019278 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019278
Domain Number 1 Region: 525-553,660-736
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000022
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019278   Gene: ENSMMUG00000014694   Transcript: ENSMMUT00000020602
Sequence length 926
Comment pep:known_by_projection chromosome:MMUL_1:1:164478800:164501589:1 gene:ENSMMUG00000014694 transcript:ENSMMUT00000020602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPRPRYLVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNTFRCSSAKIKAVVFGLLPVLS
WLPKYKIKDYIVPDLLGGLSGGSIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGV
HQMVPGTFAVISILVGNICLQLAPESKFQVFNNATNESYVDTAAMEAERLHVSATLACLT
AIIQIGLGFMQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGLTIPSYAGPGSIVFT
FIDICKNLPHTNIASLIFALISGVFLVLVKELNARYMHKIRFPIPTEMIVVVVATAISGG
CKMPKKYHMQIVGEIQRGFPTPVSPVVSQWKDMIGTAFSLAIVGYVINLAMGRTLANKHG
YDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITML
VLGTYLYPLPKSVLGALIAVNLKNSLKQLTDPYYLWRKSKLDCCIWVVSFLSSFFLSLPY
GVAVGVAFSVLVVVFQTQFRNGYALAQVMDTDIYVNPKTYNRAQDIQGIKIITYCSPLYF
ANSEIFRQKVIAKTGMDPQKVLLAKQKYLKKQEKRRMRPTQQRRSLFMKTKTVSLQELQQ
DFENASPTDPNNNQTQANGTSVSYITFSPDSSSAAQSEPPASAEAPGEPSDTLASVPPFV
TFHTLILDMSGVSFVDLMGIKTLAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGS
LECKHVFPSIHDAVLFAQANARDVTPGHNFQGAPGDPELSLYDSEEDIPSYWDLEQEMFG
SMFHTETLTALESLSAAGGCYPSRSESLVSPVFTRQALAAMDKPPARSTPPTSALSLAAE
GHLDFQLLRVSQKQKDKYNCAGLLYKLQKVSQSPHGSVSDGVRLSWDIGINLVRTLACLP
QLPQLCLWQLCTRGPCALHTQESRPW
Download sequence
Identical sequences ENSMMUP00000019278 ENSMMUP00000038177 9544.ENSMMUP00000019278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]