SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019783 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019783
Domain Number 1 Region: 32-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000000275
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 2 Region: 107-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000000288
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 3 Region: 66-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 4 Region: 146-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000746
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019783   Gene: ENSMMUG00000015093   Transcript: ENSMMUT00000021157
Sequence length 173
Comment pep:known chromosome:MMUL_1:15:74597669:74707856:-1 gene:ENSMMUG00000015093 transcript:ENSMMUT00000021157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTSARWALWLLLALCWAPWESGATGTGRKAKCEPSQFQCTNGRCITLLWKCDGDEDCVD
GSDEKNCVKKTCAESDFVCNNGQCVPNRWKCDGDPDCEDGSDESPEQCRNITCSPSEFTC
SSGRCISRNFVCNGQDDCSDGSDELDCAPPTCGVHEFQCSTSSCIPISWVCDD
Download sequence
Identical sequences ENSMMUP00000019783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]