SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021179 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021179
Domain Number 1 Region: 192-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.14e-16
Family Spermadhesin, CUB domain 0.0048
Further Details:      
 
Domain Number 2 Region: 399-437
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000209
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 3 Region: 140-177
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 4 Region: 36-135
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000589
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000021179
Domain Number - Region: 329-354
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000183
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number - Region: 357-398
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00131
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021179   Gene: ENSMMUG00000016100   Transcript: ENSMMUT00000022641
Sequence length 714
Comment pep:known chromosome:MMUL_1:7:85686119:85693011:1 gene:ENSMMUG00000016100 transcript:ENSMMUT00000022641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLATLLLLLLLGGALAHPDRIIFPNLACEDPPAVLLEVQGTLQRPLVRDSRSSPANCTW
LILGSKEQTVTIRFQKLHLACGSEHLTLRSPLQPPISLCEAPPSPLQLPGGNVTITYSYA
GARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGIDACGDGSDEAGCSSDPF
PGLTPRPIPSLPCNLTLEDFYGVFSSPGYAHLASVSHPQSCHWLLDPHDGRRLAVRFTAL
DLGFGDAVHVFDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFN
ATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPG
HFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCD
GQPDCADGSDEWDCSYVLPRKVITAAVIGSLVCGLLLVIALGCTCKLYAIRTQEYSIFAP
LSRMEAEIVQQQAPPSYGQLIAQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDMTPG
GGSGARRRQRGRLMRRLVRRLRRWGLLPRTNTPARASEARSQVTHSAAPLEALDGGTGPA
CEGGAVGGQDGEQAPPLPIKAPLPSASTSLAPTTVPEAPGPLPSLPLEPSLLSGVVQALR
GRLLPSLGPPGPTRSPAGPHTAVLTPEDEDDVLLVPLAEPGVWVAEAEDEPLLT
Download sequence
Identical sequences G7MX26
ENSMMUP00000021179 9544.ENSMMUP00000021179 NP_001244860.1.72884 ENSMMUP00000021179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]