SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021483 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021483
Domain Number 1 Region: 2-541
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 7.33e-64
Family Acetyl-CoA synthetase-like 0.00011
Further Details:      
 
Domain Number 2 Region: 754-963
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.06e-31
Family Quinoprotein alcohol dehydrogenase-like 0.011
Further Details:      
 
Domain Number 3 Region: 553-608
Classification Level Classification E-value
Superfamily ACP-like 0.0000851
Family Acyl-carrier protein (ACP) 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021483   Gene: ENSMMUG00000016360   Transcript: ENSMMUT00000022971
Sequence length 970
Comment pep:known_by_projection chromosome:MMUL_1:5:72993260:73032275:1 gene:ENSMMUG00000016360 transcript:ENSMMUT00000022971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLQELVRKAASCYMDKVAVCFDECNNQLPVYYTYKTVVNAASELSNFLLLHCDFQGIRE
IGLYCQPGIDLPSWILGILQVPAAYVPIDTDSPPSLSTHFMKKCNLKYILVEKKQINKFK
SFHETLLSYDTFTVEHNDLVLFRLHWKNTEVNLMLSDGKEKYEKEKIKISVSSEHVNEEK
AEHMDLRLKHCLAYVLHTSGTTGIPKIVRVPHECIVPNIQHFHDFLKVIKVKCYFLETAQ
EFETSLGNIVVHFSSSECLFIIFQYFKCFKEYFVFLEINKLFLMYLQATPTLLRRFGSKL
IKSNVLSATTSLRVLALGGEVFPSLTVLRSWRGEGNKTQIFNVYGITEVSSWATIYRIPE
KILNSTSKCELPVQLGFPLLGTVVEVRDTNGFTIQEGSGQVFLGGRNRVCFLDDEVTVPL
GTMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRLNIELVQQVAEELQQVESCAVTWYNQE
KLILFMVSKDASVKEYIFKELHKYLPSHAIPDELVLIDSLPFTSHGKIDVSELNKIYLNY
INLKSENKLSGKEDLWEKLQYLWKSTLNLSEDLLKVPDESLFLNSGGDSLKSIRLLSEIE
KLVGTSVPGLLEIILSSSILEIYNHILQTVFPDEDVTFRKSCATKRKLSDINQEEASVTS
LHQKAIMTLSCHNEINAFVALSRGSQILSLNTTRFSTKLGHCSSAYPSDSVSQTNIQNVK
DLNSPVLIGKSKDPSCVVKVSEEGKPVIGTQKMELHVRWRSDTGKCVDASPLVVIPTFDK
SSTTVYIGSHSHRMKAVDFYSGKVKWEQLLGDRIESSACVSKCGNFIVVGCYNGLVYVLK
SNSGEKYWMFTTGDAVKSSATMDPTTGLIYIGSHDQHAYALDIYRKKCVWKSKCGGTVFS
SPCLNPIPHHLYFATLGGLLLAVNPATGNIIWKHSCGKPLFSSPRCCSQYVCIGCVDGNL
LCFTHFGEQV
Download sequence
Identical sequences ENSMMUP00000021483 9544.ENSMMUP00000021483 ENSMMUP00000021483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]