SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023186 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023186
Domain Number 1 Region: 521-554,636-710
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000785
Family Anti-sigma factor antagonist SpoIIaa 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023186   Gene: ENSMMUG00000017618   Transcript: ENSMMUT00000024774
Sequence length 758
Comment pep:novel chromosome:MMUL_1:3:145188886:145216207:-1 gene:ENSMMUG00000017618 transcript:ENSMMUT00000024774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEPFGNQYIVARPVYSTNAFEENHKKRDRHHKTLLDHLRVCFSCSPQKAKRIVLSLFPI
ASWLPAYRLKEWLLSDIVSGISTGIVSVLQGLAFALLVTIPPGYGLYAAFFSTIIYLFFG
TSKHISAGPFPILSMMVGAATVRLAQNLPGNTGSSNNSTSNSSSLDDYKVMVAASVTVLS
GVIQLALGILRIGFVVIYLSESLISGFTTAAAVHVLVSQLKFIFQLTVPSHEDPCSIFKV
LYSVFSQIEKTNIADLVTALIVLLVVSIFKEINQRFKDKLPVPIPIEFIVTVIATGVSYG
FDFHRRFNVAVVGKMNPGFEPPNAPNVTVFQETIGDCFAIAMVGFAVAFSVASVYSLKHD
YPLDGNQELIALGLSNIVCGAFRGFAGSTALSRSAVQESTGGKTQIAGLISAIVVLIVIL
AIGFLLEPLQRSVLAALALGNLKGMLMQFAEIRRLWRKDKYDCLIWVTTCIFTIVLGLGL
GLAASVAFQLLTIVFRTQFPKCSTLANIGRSNIYKNKKDYYDMYELKGVKIFRCPSPIYF
ANIGFFKQKLIDAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDTIKDSDE
ELDNNQIQVLDEPIDTTDLPFQIDWNDQLPLNIEVPKISLHSLILDFSAVSFLDVSSMRG
LKSILQEFIRIKVDVYIVGVDDDFIEKLNRYEFFDGEVKTSILFLTIHDAVLHISMKKDY
STSKFKPSQEKDGKIDFTINTNGGLRNREYQVRFFNRF
Download sequence
Identical sequences F6W495
ENSMMUP00000023186 ENSMMUP00000023186 9544.ENSMMUP00000023186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]