SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023696 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023696
Domain Number 1 Region: 567-828
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.25e-91
Family Eukaryotic proteases 0.00000000532
Further Details:      
 
Domain Number 2 Region: 314-420
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-29
Family Spermadhesin, CUB domain 0.00087
Further Details:      
 
Domain Number 3 Region: 201-306
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-20
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 61-144
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000209
Family SEA domain 0.01
Further Details:      
 
Domain Number 5 Region: 499-536
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000089
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 6 Region: 427-462
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 7 Region: 462-499
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 8 Region: 538-578
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000715
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023696   Gene: ENSMMUG00000018034   Transcript: ENSMMUT00000025330
Sequence length 829
Comment pep:known_by_projection chromosome:MMUL_1:14:128248884:128270735:1 gene:ENSMMUG00000018034 transcript:ENSMMUT00000025330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKVNGLEEGVEFLPVNNVKKVEKRGPGRWVVLAAVLIGLLLVSLGIGFLVWHLQYRDVRV
QKIFNGYLRITNENFLDAYENSNSTEFVSLASKVKDALKLLYSGVPFLGPYHKESAVTAF
SEGSVIAYYWSEFSIPQHLVEEAERVMAEERVVMLPPRARSLKSFVVTSVVAFPTDPKTV
QRTQDNSCSFALHARGVEVMRFTTPGFPDSPYPAHARCQWALRGDADSVLSLTFRSFDLA
SCDERGSDLVTVYNTLSPMEPHTLVQLCGTYPPSYNLTFLSSQNVLLITLITNTERRHPG
FEATFFQLPKMSRCGGHLRKAQGTFNSPYYPGHYPPNIDCTWNIEVPNNQHVKVRFKFFY
LLEPGVPTGTCPKDYVEINGEKYCGERSQFVVTSNSNKITVRFHSDQSYTDTGFLAEYLS
YDSSDPCPGQFTCRTGRCIRKEMRCDGWADCTDYSDELNCSCDATHQFTCKNKFCKPLFW
VCDSVNDCGDYSDEQGCSCPAQTFRCSNGKCLSKSQQCDGKDDCGDGSDEASCPKVNVVT
CTKHTYRCLNGLCLSKGNPECDGKKDCSDGSDEKDCDCGLRSFTRQARVVGGTDADEGEW
PWQVSLHALGQGHVCGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSA
PEVQERRLKRIISHPSFNDFTFDYDIALLELEKPVEYSSVVRPICLPDASHVFPAGKAIW
VTGWGHTQYGGTGALILQKGEIRVINQTTCESLLPQQITPRMMCVGFLSGGVDSCQGDSG
GPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKEKTGV
Download sequence
Identical sequences ENSMMUP00000023696 ENSMMUP00000023696 9544.ENSMMUP00000023696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]