SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024346 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024346
Domain Number 1 Region: 883-1136,1209-1304
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.85e-32
Family Quinoprotein alcohol dehydrogenase-like 0.028
Further Details:      
 
Domain Number 2 Region: 282-483
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000107
Family Extended AAA-ATPase domain 0.075
Further Details:      
 
Domain Number 3 Region: 1271-1398
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0000000000033
Family Quinohemoprotein amine dehydrogenase B chain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024346   Gene: ENSMMUG00000018503   Transcript: ENSMMUT00000026018
Sequence length 1405
Comment pep:known chromosome:MMUL_1:19:16285810:16359783:1 gene:ENSMMUG00000018503 transcript:ENSMMUT00000026018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVVDLRWGIRNTEVTDLLTTELCLEEVDRCWKTSIGPAFVALIGDQYGPCVVPSRIDEKE
WEVLRARLTARPSDLELVARHFRRDENAVPPTYILQAPGTGEACEPEKATLTSVLRSGAQ
EARRLGLITQEQWQRYHRSVIDWEIQQGLLSSEERDQGATVFLREIQDLYKHILEDCALG
MVDRLADGCLDTDAQNLLSSLKGHITDMHPEVLKAHRLPWSRDLVNPKNKTHAQYLKELG
EQFVARANHQVLERLRELDVAGQELAWLYQEIRHHLWQSSEVTQNFCGRQELLARLGQQL
RHDDSKQHTPLVLFGPPGIGKTALMCKLVEQMPRLLGHKTVTVLRLLGTSQMSSDARGLL
KSICFQVCLAYGLPLPRAQVLDAHTRVVQFFHTLLHTVSCRNFESLVLLLDAMDDLDSVR
HARRVPWLPLNCPPRVHLILSACSGALGVLDTLQRVLLDPEAYWEVKPLSGNQGQEMIQH
LLVAARRTLSPVHTDLLWASLPESGNPGRLRLAFEEARKWVSFTVPAPLATTAEEATHQL
CARLEQTHGRLLVAHVLGYIVSSRHGLSEAELKDVLSLDDEVLQAVYRDWSPPSKELLRF
PPLLWVRLRRDLGYYLARRPVDGFTLLAIAHRSRQQIRRTHWPGTCLIVTLGVGVLLVSG
GWRPGMLLYNPQCIVQPLTAENDPAPWSLLLSLRCPGGNGEMILHLPDELEGGRHFPHPP
LFSPSGSMSWISCRGISGGIEDLLDDFDLCAPHLDSPEVGLVREALQLCRPAVELRGMGR
ALTSRNTLSSLSHELDFHQPSYLSCLNITASIIFFFDTWYRCVTQAGGFLNISLHFYSDN
FHNSFPSIFSLVNQGISQLTSILIAARSKYSQLIYSPPPWPATGEVRCVKVFAKGTLAIS
ASKDYTLRLWNLLTGQEKFAIWDGGSKNPTEPQIWSLHVDEAYKVVYSASASKINAWNLE
TAELVFHILGDASDPWMCMAMLASQATLLTVSRDGVVSLWSSATGKLQGQQHMSSIKEET
PTCAVSVQKQGKLVTGFSNGSISLVSSKEDRLLEKLPDAVRFLVVSEDESLLAAGFGRSV
RIFSADWRGFRRFMATDLEHEDMVETAVFGPENNLIVTGSLDALIQVWSLSEQGTLLDIL
EGVGAPVSLLARGGALVASASLQSSSFKVWDLSNAHRSRVPAPFLDRTGLTAVSHNGSYV
YFPKIGDKNKVTIWDLAEGKEQDSLDASSEVRCLEVAEQHELLFTGLVSGVVLVFPLNSR
QDVICIPPPEARKAIHCMSLSKWEDRLAVAYDNMVLVLDIAPGDPCPVINGPRYTFYTQL
PETISSVAILTDYRMVYSMTNGDLFLYECANSKAFPLEAHRSRVACVEVSHKEQLVVSGS
EDALLRLWDLQARKWKFEMSYTAPC
Download sequence
Identical sequences ENSMMUP00000024346 ENSMMUP00000024346 9544.ENSMMUP00000024346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]