SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025145 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025145
Domain Number 1 Region: 538-570,651-725
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000216
Family Anti-sigma factor antagonist SpoIIaa 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025145   Gene: ENSMMUG00000019125   Transcript: ENSMMUT00000026874
Sequence length 780
Comment pep:known_by_projection chromosome:MMUL_1:3:145083174:145134867:1 gene:ENSMMUG00000019125 transcript:ENSMMUT00000026874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPGGRSEPPQLPEYSCSYVVSRPVYSELAFQQQHERRLQERKTLRESLAKCCSCSRKR
AFGVLKTLLPILEWLPKYRVKEWLLSDIVSGVSTGLVATLQGMAYALLAAVPVGYGLYSA
FFPILTYFIFGTSRHISVGPFPVVSLMVGSVVLSMAPNEHFLVSSSNGTVLNTTMIDTAT
RDTARVLIASALTLLVGIIQLIFGGLQIGFIVRYLADPLVGGFTTAAAFQVLVSQLKIVL
NVSTKNYNGVLSIIYTLVEIFQNIGDTNLADFIAGLLTIVVCMAVKELNDRFRHKIPVPI
PIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFLPPALPPVSLFSEMLAASFSIAVVA
YAIAVSVGKVYATKYDYAIDGNQEFIAFGISNIFSGFFSCFVATTALSRTAVQESTGGKT
QVAGIISAGIVMIAILALGKLLEPLQKSVLAAVVIANLKGMFMQVCDIPRLWRQNKIDAV
IWVFTCIVSIILGLDLGLLAGLVFGLLTVVLRVQFPSWNGLGSIPSTDIYKSTKNYKNIE
EPQGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKNGQLRAT
KNGIISDAGSTNNAFEPDEDIEDPEELDTPTKEIEIQVDWNSELPVKVNVPKVPIHSLVL
DCGAISFLDVVGVRSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQCGFFDDNIRKDTFFL
TVHDAILYLQNQVKSQEGQDSILETITLIQDCKDTLELIETELTEEELDVQDEAMRTLAS
Download sequence
Identical sequences F6T116
9544.ENSMMUP00000025145 ENSMMUP00000025145 XP_014990157.1.72884 ENSMMUP00000025145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]