SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026923 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026923
Domain Number 1 Region: 46-184
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 3.01e-46
Family Molybdopterin synthase subunit MoaE 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026923   Gene: ENSMMUG00000020449   Transcript: ENSMMUT00000028771
Sequence length 188
Comment pep:known_by_projection chromosome:MMUL_1:6:50732441:50745065:-1 gene:ENSMMUG00000020449 transcript:ENSMMUT00000028771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLEISSSSFNQETKLPLSPPLVEDSAFEPSRKDIDEVEEKSKDVINFTAEKLSVDEVS
QLVISPLCGAVSLFVGTTRNNFEGKKVISLEYEAYLPMAKNEVKKICSDIRQKWPVKHIA
VFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSSWKGNK
ECFWVSNN
Download sequence
Identical sequences ENSMMUP00000026923 ENSMMUP00000034735 9544.ENSMMUP00000026923 ENSMMUP00000026923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]