SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030122 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030122
Domain Number 1 Region: 125-239
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000107
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 2 Region: 328-365
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 3 Region: 38-75
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 84-124
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000877
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 289-326
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000183
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000030122
Domain Number - Region: 241-287
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00209
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030122   Gene: ENSMMUG00000022872   Transcript: ENSMMUT00000032198
Sequence length 644
Comment pep:known chromosome:MMUL_1:19:39722294:39726056:1 gene:ENSMMUG00000022872 transcript:ENSMMUT00000032198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNHLPTFGPRPPGQREALLSPDCPLLPLHPTGKLGQASCQADEFRCDNGKCLPGPWQCN
AVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPVERRCDGLQDCGDGSDE
AGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDSRRVLLQLELRLGYDD
YVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNATYQVKG
YCLPWEQPCGSSSDSDGGSAGDQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQYPCEGG
SGLCYTPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDCQDGSDE
HGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRLEAEFVR
REAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSRRRLGR
LWNRLFHRPRVPRGQIPLLTAARPSQTVLGDGFLQPAPGAAPDPPAPLTDTGSPRVAGDG
PPSAPSHAPEVGPSGPPLPSGLRDPECRPVDKDRKVCREPLADGPAPVDAPREPCSAQDP
HPQASTASSTLGPHSPEPLGVCRSPPPPCSPMLEASDDEALLVC
Download sequence
Identical sequences ENSMMUP00000030122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]