SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031412 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031412
Domain Number 1 Region: 389-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 277-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 222-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.14e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 333-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 433-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.78e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 1-47
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-18
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 7 Region: 186-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000752
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031412   Gene: ENSMMUG00000000361   Transcript: ENSMMUT00000038313
Sequence length 493
Comment pep:novel chromosome:MMUL_1:19:62360105:62364817:1 gene:ENSMMUG00000000361 transcript:ENSMMUT00000038313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFQDVAIDFSKEEWGFLNPAQRDLYTTVMLENYQNLVWLGLSISKSVISLLEKRKLPWIM
GKEEIRVPLPATIYIYFYKCLWAQKLQVCLSSLSMLVNSLEEHHHSDASLFKSIETCSEF
TFEKGNQSKTKTLDEYIILQVRKQLKFNLFSSSDTPGAEIKELSAKRAINEVLSQFDTVI
KCTRNICKECGNVYCHNTQLTLRKRNHTRKKCNQCLDCGKHFTRRSTLIQYQRIHTGERP
YKCNECSKTFNQRAHLTQHERIHMGEKPYKCKEGRKTFSQMTHLTQHQSTHTREKFHECS
ECGKAFSRSSALMDHQRIHSGEKPYECKECGRAFTQSAQLIRHQKTHSGEKPYECSKCKK
SFVRLSSLIEHWRTHTGEKPYQRKDCKKTFCRVMQLTLHRRVHTGEKPYECKQCGKAFSA
HSSLVTHKRTHSGEKPYKCKECGKAFSAHSSLVTHKRTHTGEKPYKCHACGKAFNTSSTL
CQHNRIHTGEKPF
Download sequence
Identical sequences ENSMMUP00000031412 ENSMMUP00000031413 9544.ENSMMUP00000031412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]