SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031947 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031947
Domain Number 1 Region: 8-106
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-21
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 2 Region: 108-225
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000497
Family Spermadhesin, CUB domain 0.0054
Further Details:      
 
Domain Number 3 Region: 228-254
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000576
Family LDL receptor-like module 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031947   Gene: ENSMMUG00000028921   Transcript: ENSMMUT00000038866
Sequence length 408
Comment pep:known_by_projection chromosome:MMUL_1:8:126720050:126721489:1 gene:ENSMMUG00000028921 transcript:ENSMMUT00000038866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDILVQTSNGGHFALPNYPISYPNKECIYILEAAPCERIEFDEHYYYIEPSFECRFDHLE
VPDGSFGFSPLIDRYCSMKSPPLIRSTGRFMWIKFSSDEKNLDPDFTYLADCGFELSRAD
GIVHSSQVEQEEKIKPGQVIDCIWTMKATPKARIRFLDYQMECSNKCKRNFVAVYDETSY
IENLKAKFCSTVASDGMLKTGIGVIQVWADQGRWLSRFQMLFASFIEHSNMCINNPLVCN
GVQNCAYPWDENHCKEKRGLFEQNTETHGTIIGITSEIVLVLLIIAVLVQVKQSQKNVMA
YETAFHKIGFQEMFDPLHYELFSLRDKDISANLTDLSEELNNYQKTWHSSTTSQCIHDHH
WGFLTSSIKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFEQ
Download sequence
Identical sequences ENSMMUP00000031947 ENSMMUP00000031947 9544.ENSMMUP00000031947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]