SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033203 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033203
Domain Number 1 Region: 26-117
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-20
Family ALDH-like 0.0000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033203   Gene: ENSMMUG00000006659   Transcript: ENSMMUT00000040127
Sequence length 126
Comment pep:known chromosome:MMUL_1:7:81008123:81020416:1 gene:ENSMMUG00000006659 transcript:ENSMMUT00000040127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTNGAVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFATYNPSTLEKI
CEVEEGDKPDVDKAVEAAQAAFQRGSPWRRLDALSRGRLLHQLADLVERDRATLAGSSHY
SHPKAS
Download sequence
Identical sequences ENSMMUP00000033203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]