SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034800 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034800
Domain Number 1 Region: 24-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000798
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 2 Region: 140-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000681
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 80-128
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000667
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034800   Gene: ENSMMUG00000021034   Transcript: ENSMMUT00000041786
Sequence length 486
Comment pep:known_by_projection chromosome:MMUL_1:6:41022958:41081343:-1 gene:ENSMMUG00000021034 transcript:ENSMMUT00000041786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARHSILYFILLSALINKGQGCFCDHYPWSQWSSCSKTCNSGTQSRHRQIVVDKYYQENF
CEQICSKQETRECNWQSCPINCLLGDFGPWSDCDPCVEKQSKVRSVLRPSQFGGQPCTEP
LVVFQPCIPSKLCKIEEADCKNKFRCDSGRCIARKLECNGENDCGDNSDERDCGRTKAVC
ARKYNPIPSVQLMGNGFHFLAGEPRGEVLDNSFTGGICKTVKSSRTSNPYRVPANLENVG
FEVETAEDDLKTDFYKDLTSLGHNENQQGSFSSQGGSSFRVPIFYSSKRSENINHNSAFK
QAIQASHKKDSSFIRIHKVMKVLNFTTKAKDLYLSDVFLKALNHLPLEYNSALYTRIFDD
FGTHYFTSGSLGGVYDLLYQFSSEELKNSGLTEEETKHCVRIETKKRVLFVKKTKVEHRC
TTNKLSEKHEGSFLQGAEKSISLIRGGRSEYAAALAWEKGSSGLEEKTFSDWLESVKENP
AVIDFE
Download sequence
Identical sequences ENSMMUP00000034800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]