SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034878 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034878
Domain Number 1 Region: 432-820
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.12e-131
Family Ankyrin repeat 0.000000000348
Further Details:      
 
Domain Number 2 Region: 188-450
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.61e-73
Family Ankyrin repeat 0.000003
Further Details:      
 
Domain Number 3 Region: 32-222
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.82e-47
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 4 Region: 3547-3656
Classification Level Classification E-value
Superfamily DEATH domain 2.94e-25
Family DEATH domain, DD 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034878   Gene: ENSMMUG00000008633   Transcript: ENSMMUT00000041869
Sequence length 3938
Comment pep:known chromosome:MMUL_1:5:105899218:106226853:1 gene:ENSMMUG00000008633 transcript:ENSMMUT00000041869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMNEDAAQKSDSGEKFNGSSQRRKRPKKSDSNASFLRAARAGNLDKVVEYLKGGIDINTC
NQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEG
ANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVA
ILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIA
AHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGL
TPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDD
VTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKY
GASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVV
RCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISARE
GQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPL
HVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTK
QGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGAD
QDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVL
LQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMT
EVLDVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLR
SFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQVSTLAKEAERNSYRLSWGTENLDNVALS
SSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPM
VEGEGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVE
IPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRIC
RIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQP
MHTELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRL
LCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYRE
IICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKP
IYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGL
VHQAICNLNITLPIYTKESESDQEQEEELTCVLRRDDETESTETSVLKSHLVNEVPVLAS
PDLLSEVSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLE
KVNEILRSGTCTRDEGSVQSSRSERGLVEEEWVIVSDEEIEEARQKAPLEITEYPCVEVR
IDKEIKGKVEKDSEQLQTVQDKAGKKREALAVGKSSEKEGKDIPPDETQSTQKQQKPSLG
IKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLDEDPGLAPEPLPTVKATSPLIE
ETPIGSIKDKVKALQKRVEDEQKGRSKLPIRVKGKEDVPKKTTHRTHPAASPSLKTERHA
PGSPSSKTERHSALSSSAKTERYPPVSPSSKTEKHSPVSPSAKTERHSPMSSSSKTEKHS
PVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTEKHPPVSPGRTEKRLPV
SPSGRTDKHQPVSTAGKTEKHLPMSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQS
GQDPSKHKTGLFEHKSAKQKQPQEKGKVRIEKEKGPILTQRETQKTENQTIKRGQRLPVT
GTTESKRGVRASSIGVKKEDAAGEKEKILSRKIPEPVQSAPEGESHRESEVPKEKMADEQ
GDMDLQISPDRKTSTDFSEVIKQELEDNDKYQQFCLSEETEKAQLHLDQVLTSPFNTTFP
LDYMKDEFLPALSLQSGALDGSSESLKNEGVAGSPCGSLMEGTPQISSEESYKHEGLAET
PETSPESLSFSPKKSEEQIGETKESTKIETTTEIHSEKEHPTTKDITGGSEERGATVTEG
SETSTEGFQKEATLGSPKDTSAKRKDDCTGSCSVALAKETPTGLTEEAACDEGQPTFGSS
DHKTQADSEAQESTATSDETKASPLPEASVKTDTGTESKPQGVIRSPQGLELALPSRDSE
VLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKESPCRDSLESSPVEPKMK
AGIFPSHFPLPAAVAKTELLMEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPD
TPSSEEVSYEVTPKTSDVSTPKPAVIHECAEEDDSENGEKKRFTPEEEMFKMVTKIKMFD
ELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKCTGSGEDESGVPGLVTSESRK
VSSSSESEPELTELKKGADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPIVSKQYT
FKMNEEIQEEPGKSEGEKDSESHLAEDSHAVSTEAADNSFDKLNRDTDQPEICGGHGCEA
MSPSSSAAPVSSGLQSPTDDDIDEQPVIYKESLALQGSHEKDTEGEELDVSRAESPRVDC
PSEGFSPSSSLPHCLVSEGKELDEDISTTSSIQKTEITKTDETFENLPKDCPTQDSSITT
QTDRFSMDVPVSDLAETDEIYDRQITSPYENVPSQSFFSSEESKTQTDANHTTSFHSSEV
YSVTITSPVEDVVVASSSSGTVLSKESNFEVQDIKVESQQESTLWEMQSDNASSSFEPTM
SATTAVVGEQISKVIITKTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTT
PDTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYADESFHFFQIGQESR
EETLSEDVQEGATGAEPLPLETSTESLALPESKETVDDEADLLPDDLSEEVEEIPASDAQ
LNPQMGISASPETPTKEAVSVGTKDLPTMQTGDMPPLSGVKQISCPDSSEPVAQVQLDFS
TVTRSVYSDRGGDSPDSSPEEQKSVIEIPTAPMENVPSTESKSKIPVRTMPTYTPAPPSA
EYESSLSEDLLSSVDEENNEDEAKPKSKLPVKVPLQRVEQQLSDLDTPVQETVAPQGQDM
TSIAPDNRSKSESDASSLDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILT
SRLPVKSRSTTSSCRGGTSPTKESKEHFFDLYRNSIEFFEEISDEASKLVDRLTQSEREQ
ELVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESIETLIERIPDENGHDHA
EDPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKY
WLERDGKHATDTNLIECLTKINRMDIVHLMETNMEPLQERISHSYAEIEQTITLDHSEGF
SVLQEELCTAQHKQKEEQALSKESETCDHPPIVSEEDISVGYSTFQDGIPKTEGDSSATA
LFPQTHKEQVQQDFSGKMQDLPEESSLEYRQEYFVTTPGTEASETQKATTVPGSPSKTPE
EVSTPPEEDRLYLQTPTSSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETR
ERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEIT
VQGMPQEPVNIEEGDGYSKVIKRVVLKSDTEQSEVRQP
Download sequence
Identical sequences 9544.ENSMMUP00000034878 ENSMMUP00000034878 ENSMMUP00000011331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]