SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035797 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035797
Domain Number 1 Region: 434-827
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.21e-133
Family Ankyrin repeat 0.000000000181
Further Details:      
 
Domain Number 2 Region: 197-452
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.25e-73
Family Ankyrin repeat 0.00000265
Further Details:      
 
Domain Number 3 Region: 47-259
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.8e-55
Family Ankyrin repeat 0.000014
Further Details:      
 
Domain Number 4 Region: 4085-4189
Classification Level Classification E-value
Superfamily DEATH domain 2.68e-25
Family DEATH domain, DD 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035797   Gene: ENSMMUG00000003589   Transcript: ENSMMUT00000042785
Sequence length 4373
Comment pep:known_by_projection chromosome:MMUL_1:9:76898809:77258462:1 gene:ENSMMUG00000003589 transcript:ENSMMUT00000042785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHAASQLKKNRDLEINAEEEPEKKRKHRKRSRDRKKKSDANASYLRAARAGHLEKALDY
IKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQA
EVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVA
LQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLH
IAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD
GLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPV
DDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLL
KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAE
VVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSA
REGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLT
PLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAV
TRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQG
AHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIIN
VLLQNNASPNELTVNGNTALGIARRLGYISVVDTLKIVTEETMTTTTVTEKHKMNVPETM
NEVLDMSDDEVRKANAPEMLSDGEYISDVEEGEDAMTGDTDKYLGPQDLKELGDDSLPAE
GYMGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSL
RHYSWAADTLDNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRI
TCRLVKRHKANPPPMVEEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRS
ENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKKRICRIITKDFPQYFAVVSRIKQ
ESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVKKILGNKATFSPI
VTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDSTPNLRLLCSITGGTSPAQWEDITG
TTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKMND
PVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQ
LVFNFYAFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHKKE
TESDQDDEIEKTDRRQSFASLALRKRYSYLTEPGMIERSTGATRSLPTTYSYKPFFSTRP
YQSWTTAPITVPGPAKSGFTSLSSSSSNTPSASPLKSIWSVSTPSPIKSTLGASTTSSVK
SISDVASPIRSFRTISSPIKTVVSQSPYNIQVSSGTLARAPAVTEATSLKGLASNSTFSS
RTSPVTTAGSLLERSSITMTPPASPKSNINMYSSSLPFKSIITSAAPLISSPLKSVVSPV
KSAVDVISSAKVTMASSLSSPVKQMPGHAEVALVNGSISPLKYPSSSTLINGCKATATLQ
EKISSATNSVSSVVSAATDTVEKVFSTTTAMPFSPLRSYVSAAPSAFQSLRTPSASALYT
SLGSSISATTSSVTSSIITVPVYSVVNVLSEPALKKLPDSNSFTKSAAALLSPIKTLTTE
TRPQPHFNRTSSPVKSSLFLAPSALKLSTPSSLSSSQEILKDVAEMKEDLMRMTAILQTD
VPEEKPFQPELPKEGRIDDEEPFKIVEKVKEDLVKVSEILKKDVCVDNKGSPKSPKSDKG
HSPEDDWIEFSLEEIREARQQAAASHSPSLPERVQVKAKAASEKDYNLTKVIDYLTNDIG
SSSLTNLKYKFEDAKKDGEERQKRVLKPAIALQEHKLKMPPASMRPSTSEKELCKMADSF
FGTDTILESPDDFSQHDQDKSPLSDSGFETRSEKTPSAPQSAESTGPKPLFHEVPIPPVI
TETRTEVVHVIRSYEPSAGDVPQTQPEEPVSPKPSPTFMELEPTPTTSSIKEKVKAFQMK
ASSEEDDHNRVLSKGMRVKEETHITTTTRMVYHSPPGGEGASERIEETMSVHDIMKAFQS
GRDPSKELAGLFEHKSAVSPDVHKSAAETSAQHAEKDNQMKPKLERIIEVHIEKGNQAEP
TEVIIRETKKHPEKEMYVYQKDLSRGDINLKDFLPEKHDAFPCSEEQGQQEEEELTAEES
LPSYLESSRVNTPVSQEEDSRPSSAQLISDDSYKTLKLLSQHSIEYHDDELSELRGESYR
FAEKMLLSEKLDVSHSDTEESVTDHAGPPSSELQGSDKRSREKVATAPKKEILSKIYKDV
SENGVGKVSKDEHFDKVTVLHYSGNVSSPKHAMWMRFTEDRLDRGREKLIYEDRVDRTVK
EAEEKLTEVSQFFRDKTEKLNDELQSPEKKARPKNGKEYSSQSPTSSSPEKVLLTELLAS
SDEWVKTRQHGPDGQGFPKAEEKAPSLPSSPEKTVLSQQTEDSKSTVEAKGSISQSKALD
GPQSGFQLKQSKLSSIRLKFEQGTHAKSKDMSQEDRKSDGQSRIPVKKIQESKLPVYQVF
AREKQQKAIDLPDESVSVQKDFMVLKAKDEHAQSNEIVVNDSGSDNVKKQRTEMSSKAVP
DSFSEQQAKDLACHITSDLATRGPWDKKVFRTWESSGATNNKSQKEKLSHVLVHDVRENH
IGHPESKSVDQKSEFLSVTEREHKLLTNGSLSEIKEMTVKSPSKKVLYREYVVKEGDHPG
GLLDQPSRRSESSAMSHIPIRVADERRMLSSDISDGFCEQSAFPKHELSPKLSQSSMSKE
TVETQHFNSIEDEKVTYSEISKVSKHQSYVGLCPPLEETETSPTKSPDSLEFSPGKESPS
SDVFDHSPIDGLEKLAPLAQTEGGKEIKTLPVYVSFVQVGKQYEKEIQQGSVKKIISQEC
KTVQETRGTFYTTRQQKQPPSPQGSPEDDTLEQVSFLDSSGKSPLTPETPSSEEVSYEFT
SKTPDSLIAYIPGKPSPIPEVSEESEEEEQAKSTSLKQTTVEETAVAREMPHDVSKDSNQ
RPKNNRVAYIEFPPPPPLDADQIESDKKHHFLPEKEVDMIEVNLQDEHDKYQLAEPVIRV
QPPSPVPPGADVSDSSDDESIYQPVPVKKYTFKLKEVDDEQKEKSKASAEKASNQKELES
NGSGKDNEFGLGLDSPQNETAQNGNNDQSITECSIATTAEFSHDTDATEIDSLDGYDLQD
EDDGLTESDSKLPNQVMEIKKDIWNTEGILKPADRSFSQSKLEVIEEEGKVGPDEDKPPY
KSSSSERTPDKTDQKSGAQFFTLEGRHPDRSVFPDTYFSYKVDEEFATPFKTVATKGLDF
DPWSNNRGDDEVFDSKSREDETKPFGLAVEDRSPATTPDTTPARTPTDESTPTSEPNPFP
FHEGKMFEMTRSGAIDMSKRDFVEERLQFFQIGEHTSEGKSGDQGEGDKSMVTATPQPQS
GDTTVETNLERNVETPTVEPNPSIPTSGECQEGTSSSGSLEKAAAATNTSKVDPKLRTPI
KMGISASTMTMKKEGPGEITDKIEAVMTSCQGLENETLTVISNTANSQTGVRPHEKHDFQ
KDNFNNNNNLDSSTIQTDNIINNVVLTEHSAPTCTTEKDNPVKVSSGKKTGVLQGHCIRD
KQKVLGEQQKTKELIGIRQKSKLPVKATSPKDTFPPNHMPNTKASKMKQVSQSENTKALT
TSSCVDAKSRIPVKNTHRDNIVAVRKACATQKQGQPEKGKAKQLPSKLPVKVRSTCVTTT
TTTTTATTTTTTTTTSCTVKVRKSQLKEVCKHSIEYFKGISGETLKLVDRLSEEDKKMQS
ELSDEEESTSRNTSLSETSRGGQPSVTTKSARDKKTEAAPLKSKSEKAGSEKRSSRRTGP
QSPCRTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTR
DGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDGWQNET
SSGNLEAPAQARRVTGGLLDRLDDSPDQCRDSITSYLKGEAGKFEANGSHTEITPEAKTK
SYFPESQNDVGKQSTKETLKPKIHGSGHVEEPASPLAAYQKSLEESSKFVIEETKPCVPV
SMKKMSRTSPADGKPRLNLHEEEGSSGSEQKQGEGFKVKTKKEIRHVEKKSHS
Download sequence
Identical sequences ENSMMUP00000035797 9544.ENSMMUP00000035797 ENSMMUP00000004791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]