SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035976 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035976
Domain Number 1 Region: 218-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-18
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 263-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.69e-18
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 3 Region: 1-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.29e-18
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 4 Region: 319-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-16
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 5 Region: 193-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000029
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 140-184
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000236
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 376-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000154
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035976   Gene: ENSMMUG00000011617   Transcript: ENSMMUT00000042962
Sequence length 423
Comment pep:novel scaffold:MMUL_1:1099548049765:1052392:1066249:1 gene:ENSMMUG00000011617 transcript:ENSMMUT00000042962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGVLTFRAVAIEFCPEEWECLHSAQQHLYRNVMLENYRNLLFLKTGFAVSKSKLITCLEQ
GKESWNVKRQETAAKHLGLYLGLFFTAEILPKQDIKYSSKNITLIKYESCDLDNLYLKKY
WQGVNNCKGQNCLHQCLSTTHSKTCQCNKCGKAFDWCSILTEDRKICSREKPYKCDECGK
ACRMPYKHKRTHTRGESYKCEECGRAFTCSSTLTKHKKRIHAGEKPYKCEECGRVFTHSS
TLIKHKRIHTGEKPYKCEEFGRAFKNFSDLTKRKIIHTVERPYKCEEYGKVCKWFSELTK
HKRIHTREKPYKCEDCGKAYTWSSGLTNHKRTRAGDKPYTCEEYGTAFSCFSAFLKHRIV
HAAKRPYKCGECGKASSLTKHNRIHYEEKFKCSKCEKALNMSSDFVLNQRFHTEKIQCKC
NHC
Download sequence
Identical sequences ENSMMUP00000035976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]