SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036869 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036869
Domain Number 1 Region: 24-498
Classification Level Classification E-value
Superfamily ALDH-like 2.75e-130
Family ALDH-like 0.00000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036869   Gene: ENSMMUG00000002489   Transcript: ENSMMUT00000003540
Sequence length 510
Comment pep:known_by_projection chromosome:MMUL_1:14:68343026:68344558:1 gene:ENSMMUG00000002489 transcript:ENSMMUT00000003540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTLLINQPQYAWLKELGLREENEGVYNGSWGGREEVITTYCPANNEPIARVRQASVADY
EETVKKAKEAWKIWADIPAPKRGEIVRQIGDALREKIQVLGSLVSLEMGKILVEGVGEVQ
EYVDICDYAVGLSRMIGGPILPSERPGHALIEQWNPVGLVGIITAFNFPVAVYGWNNAIA
MICGNVCLWKGAPTTSLISVAVTKIIAKVLEDNKLPGAICSLTCGGADIGTAMAKDERVN
LLSFTGSSQVGKQVALMVQERFGRSLLELGGNNAIIAFEDADLSLVVPSARFAAVGTAGQ
RCTTARRLFVHESIHDEVVNRLKKAYAQIRVGNPWDSNVLYGPLHTKQAVSMFLGAVEEA
KKEGGTVVYGGKVMDRPGNYVEPTIVTGLAHDASIAHTETFAPILYVFKFKNEEVFAWND
EVKQGLSSSIFTRDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGSESG
SDAWKHYMRRSTCTINYSKDLPLAQGIKFQ
Download sequence
Identical sequences ENSMMUP00000036869 9544.ENSMMUP00000036869 ENSMMUP00000036869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]