SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038636 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038636
Domain Number 1 Region: 59-152
Classification Level Classification E-value
Superfamily FKBP-like 1.9e-26
Family FKBP immunophilin/proline isomerase 0.00000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038636   Gene: ENSMMUG00000031551   Transcript: ENSMMUT00000045598
Sequence length 153
Comment pep:novel chromosome:MMUL_1:11:112204224:112205056:1 gene:ENSMMUG00000031551 transcript:ENSMMUT00000045598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPSNSVGRMKREVFWVQQQASKMLPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAV
KVRHILCEKHGKIMEAVEKLKSGMRFNEVASQYSEDKARQGGDLGWMTRGSMVGPFQEAA
FALPVSGMDKRVFTDPPVKTKFGDHIIMVEGRK
Download sequence
Identical sequences ENSMMUP00000038636 ENSMMUP00000038636 9544.ENSMMUP00000038636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]