SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038853 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038853
Domain Number 1 Region: 356-547
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.59e-50
Family cAMP-binding domain 0.0000000274
Further Details:      
 
Domain Number 2 Region: 89-359
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-36
Family Voltage-gated potassium channels 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038853   Gene: ENSMMUG00000023142   Transcript: ENSMMUT00000045807
Sequence length 777
Comment pep:known_by_projection chromosome:MMUL_1:1:133834833:133847240:1 gene:ENSMMUG00000023142 transcript:ENSMMUT00000045807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEQGPVAGASEGATPGLEAPKVPPVAPRPATAASGPIPGSESEPKRRHLGTLLQPTVN
KFSLRVFGSHKAVEIEQERVKSAGAWIIHPYSDFRFYWDLIMLLLMVGNLIVLPVGITFF
KEENSPPWIVFNVLSDTFFLLDLVLNFRTGIVVEEGAEILLAPRAIRTRYLRTWFLVDLI
SSIPVDYIFLVVELEPQLDAEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF
HMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPPDCWVSINHMVNHSWGRQY
SHALFKAMSHMLCIGYGQQAPVGMPDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRR
QYQEKYKQVEQYMSFHKLPADTRQRIHEYYEHRYQGKMFDEESILGELSEPLREEIINFT
CRGLVAHMPLFAHADPSFVTAVLTKLRFEVFQPGDLVVREGSMGRKMYFIQHGLLSVLAR
GARDTRLTDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNAVLEEFPMMRRAFET
VAMDRLRRIGKKNSILQRKRSEPSPGSSGGGIMEQHLVQHDRDMARGVRGLAPSTGARLS
GKPVLWEPLVHAPLQAAAVTSNVAIALTHQRGPLPLSPDSPATLLARSARRSAGSPASPL
VPVRAGPWASTSRLPAPPARTLHASLSRAGCSQVSLLGPPPGGGGRRLGPRGRPLSASQP
SLPQRASGDGSPGRKGSGNERLPPSGLLAKPPRTAQPPRPPVPEPATPRGLQLSANM
Download sequence
Identical sequences ENSMMUP00000030464 ENSMMUP00000038853 9544.ENSMMUP00000038853 XP_001115891.1.72884 ENSMMUP00000030464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]