SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040131 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040131
Domain Number 1 Region: 73-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000707
Family LDL receptor-like module 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000040131
Domain Number - Region: 121-150
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000131
Family LDL receptor-like module 0.0049
Further Details:      
 
Domain Number - Region: 156-197
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000864
Family LDL receptor-like module 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040131   Gene: ENSMMUG00000032096   Transcript: ENSMMUT00000047105
Sequence length 199
Comment pep:known_by_projection chromosome:MMUL_1:1:56881398:56890100:-1 gene:ENSMMUG00000032096 transcript:ENSMMUT00000047105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGENDYAAAGPKAQPEGEAGCGPLCCSRRRACLSASLLFLLATLAALIALVTILGLPSRT
PGAQACITLTNRTGFLCHDQRSCIPASGVCDGVRTCTHGEDEDESLCRDVPQSLPRFLVA
HCGDPASWIYSDQKCDGTNNCGDCSDELSPVTVCPPCGPGWWHCPSTFFKYCDCIPRRLC
RDHIQHCSDWSEEYACPGP
Download sequence
Identical sequences 9544.ENSMMUP00000040131 ENSMMUP00000040132 ENSMMUP00000040131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]