SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000041073 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000041073
Domain Number 1 Region: 46-216,264-335
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.41e-36
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 1132-1214,1257-1409
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-31
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 3 Region: 812-967,1007-1083
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.73e-28
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 4 Region: 526-666
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000000942
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000041073
Domain Number - Region: 1416-1490
Classification Level Classification E-value
Superfamily EF-hand 0.00371
Family Polcalcin 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000041073   Gene: ENSMMUG00000008618   Transcript: ENSMMUT00000048032
Sequence length 1622
Comment pep:known chromosome:MMUL_1:X:47061514:47083684:-1 gene:ENSMMUG00000008618 transcript:ENSMMUT00000048032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPKRRNQHSKHKTVAVASAQRSPRALFCLTLANPLRRSCISIVEWKPFDILILLTIFANC
VALGVYIPFPEDDSNTANHNLEQVEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGWNLL
DFIIVVVGLFSVLLEQGPGRPGDAPHTGGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIV
LNSIMKALVPLLHIALLVLFVIIIYAIIGLELFLGRMHKTCYFLGSADLEAEEDPSPCAS
SGSGRACTLNQTECRGRWPGPNGGITNFDNFFFAMLTVFQCVTMEGWTDVLYWMQDAMGY
ELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKQREKQQMEEDLRGYL
DWITQAEELDMEDPSADGNLGSMASLPASDTGSMTETQGDEDEEEGALASCTRCLNKIMK
TRVCRRLRRANRVLRARCRRAVKSNACYWAVLLLVFLNTLTIASEHHGQPVWLTQIQGTP
PACQSSPPASYSFYPRSLNPGPLRLHNEPPCPASPTSYSHLTPTPKSVLTLTPKLYEPNL
PRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDQTHTKRSTFD
TFPQALLTVFQILTGEDWNVVMYDGIMAYGGPFFPGMLVCIYFIILFICGNYILLNVFLA
IAVDNLASGDAGTAKDKESLTGNPSDTPTTRDASRHPGNPHLQIPSASRRFYGTQERSVL
TVSIPLCPSAAITPISSHREKSSEKDLPPENEGLVPGVEKEEEEGTRSAGGVELLQEVVP
KEKVVPIPEGSAFFCLSQTNPLRKGCHTLIHHHVFTNLILVFIILSSVSLAAEDPIRAHS
FRNHILGYFDYAFTSIFTVEILLKMTVFGAFLHRGSFCRSWFNMLDLLVVSVSLISFGIH
SSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIG
VQLFKGKFYTCTDEAKHTPQECKGSFLVYPDGDVSRPLVRERLWVNSDFNFDNVLSAMMA
LFTVSTFEGWPALLYKAIDAYAEDHGPIYNYRVEISVFFIVYIIIIAFFMMNIFVGFVII
TFRAQGEQEYQNCELDKNQRQCVEYALKAQPLRRYIPKNPHQYRVWATVNSAAFEYLMFL
LILLNTVALAMQHYEQTAPFNYAMDILNMVFTGLFTIEMVLKIIAFKPKHYFTDAWNTFD
ALIVVGSVVDIAVTEVNVRTGLSTNPLSPYTPSLTSILGLPFIPSPQSSEDSSRISITFF
RLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIAMIFFIYAVIGMQMFGKVALQ
DGTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLASLPGNRCDPESDFGPGEEFTCGSN
FAIAYFISFFMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPGAKG
HIKHLDVVALLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVTFNATLFALVRTSL
KIKTEVGPSPSSEPQNGSCPTSSSNAGNLEQANQELRIVIKKIWKRMKQKLLDEVIPPPD
EEEVTVGKFYATFLIQDYFRKFRRRKEKGLLGNEAAPSTSSALQAGLRSLQDLGPEMRQA
LT
Download sequence
Identical sequences ENSMMUP00000041073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]