SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000041386 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000041386
Domain Number 1 Region: 2-96
Classification Level Classification E-value
Superfamily Immunoglobulin 8.26e-34
Family V set domains (antibody variable domain-like) 0.0000274
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000041386   Gene: ENSMMUG00000032616   Transcript: ENSMMUT00000048351
Sequence length 102
Comment pep:novel scaffold:MMUL_1:1099214046494:196:501:1 gene:ENSMMUG00000032616 transcript:ENSMMUT00000048351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DIVMTQTPLSLPVTPGEPASISCRSSQSLLHSGGKTYLYWYLQKPGQSPQLLIHEVSNRA
SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIQLPPT
Download sequence
Identical sequences 9544.ENSMMUP00000041386 ENSMMUP00000041386 ENSMMUP00000041386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]