SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83815558|ref|YP_444604.1| from Salinibacter ruber DSM 13855

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83815558|ref|YP_444604.1|
Domain Number 1 Region: 75-310
Classification Level Classification E-value
Superfamily PRTase-like 2.67e-39
Family Phosphoribosylpyrophosphate synthetase-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|83815558|ref|YP_444604.1|
Sequence length 325
Comment ribose-phosphate pyrophosphokinase [Salinibacter ruber DSM 13855]
Sequence
MPDDLRLFALSESRGFGEAIASALDTELDAHHERTFTDGEHEVRPEVNVRGRDVFVVQSL
YADDTWSVNDKLCRLLFMLGALRDASAERVTAVIPYLCYQRKDRKTRPRGPVTTRYVAGL
FEAVGVDRVLTMDVHNLAVLQNAFQARTEHLLGHPLFVHRLTDVVGAEEVAVVSPDEGGV
KRAGKFAEGLGAVLNCEVPTAFVEKMRKDDGVTGGALVGSVEDRTAIVVDDMVSTAGTMT
QAIRSCAEEGAESVYAVATHGLFVGEADERLETAPLDALFVTNTVAPRLTGAAAERLQIC
NAAPRFAAAIQAVHTETSVSALNEV
Download sequence
Identical sequences D5H601 Q2S5C7
WP_011403237.1.91540 YP_444604.1.20240 gi|294506350|ref|YP_003570408.1| gi|83815558|ref|YP_444604.1| 309807.SRU_0459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]