SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|108803787|ref|YP_643724.1| from Rubrobacter xylanophilus DSM 9941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108803787|ref|YP_643724.1|
Domain Number 1 Region: 73-344
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.2e-80
Family L-arabinose binding protein-like 0.00000915
Further Details:      
 
Domain Number 2 Region: 15-72
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000000197
Family GalR/LacI-like bacterial regulator 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|108803787|ref|YP_643724.1|
Sequence length 348
Comment LacI family transcriptional regulator [Rubrobacter xylanophilus DSM 9941]
Sequence
MSLVNVSVNDYTAGVATIRDVAREAGVSVATVSRVFGGGGVSAGTRERVLAASERLGYRP
NAVARALRVEATRTLGLVIPNVMNPFFTAVARAVEDAARERGYSLILGNTDEDPEKEARY
LEVLLEKRVDGIAISPARAASPHLAEIERAGVPVVFLDRYVAGVEAPVVRADGRRAVDEL
VGYLAGLGHRRLAIISGPPETVTGGERLESFLAGARRRGIGVPEERVAYGDFRRESGARA
MRRLLRLAEPPTAVFAANNLMALGALEELDRAGVRVPEEMSFASFDDVSWFRLLRPPVTA
IAQPIRRLGEAAARMLPEMVEGRERPGSVVLEAELVVRGSCAAPGGGG
Download sequence
Identical sequences Q1AXG6
gi|108803787|ref|YP_643724.1| 266117.Rxyl_0945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]