SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|108804222|ref|YP_644159.1| from Rubrobacter xylanophilus DSM 9941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108804222|ref|YP_644159.1|
Domain Number 1 Region: 25-154
Classification Level Classification E-value
Superfamily RNase III domain-like 4.19e-28
Family RNase III catalytic domain-like 0.0015
Further Details:      
 
Domain Number 2 Region: 110-222
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 6.28e-23
Family Double-stranded RNA-binding domain (dsRBD) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|108804222|ref|YP_644159.1|
Sequence length 233
Comment RNAse III [Rubrobacter xylanophilus DSM 9941]
Sequence
MWRSGAWNSNIATGMSIKELIEILPDPLRKRALTHPSVADPYHSNGRLEFLGDSILNHRV
AELVFHSYPELLEGDLTRIRAHLVRKSFLASVGRSEGLEEMIESSVINDSVIADTVEAII
GAAYLIDKNLVLRTIDEIFNPAEVDTDELRDWKTLLQETLQAEGLRPTYRVISKQGPPHR
PVFISGVSVDGEEVATGRGSSIKQSEQAAARAALEILGVRPLPRSPVEVHVGA
Download sequence
Identical sequences Q1AW81
gi|108804222|ref|YP_644159.1| 266117.Rxyl_1384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]